PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10027458
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 294aa    MW: 32985.4 Da    PI: 6.6372
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10027458genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.11.8e-121663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd +l  ++ + G g+ +t++ + g+ R +k+c++rw +yl
      Lus10027458 16 KGLWSPEEDHRLRSYIVKNGHGCRTTVPIHAGLQRNGKSCRLRWINYL 63
                     678*******************************************97 PP

2Myb_DNA-binding48.32.4e-1569114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++ E++ +v ++++lG++ W+ I+++++ gRt++++k++w++yl
      Lus10027458  69 RGLFSAYEEDTIVTLHRLLGNK-WSQISQHLP-GRTDNEIKNHWHSYL 114
                      6779999***************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-17866IPR009057Homeodomain-like
PROSITE profilePS5129414.311163IPR017930Myb domain
SuperFamilySSF466893.67E-2413110IPR009057Homeodomain-like
SMARTSM007171.6E-41565IPR001005SANT/Myb domain
PfamPF002492.5E-91663IPR001005SANT/Myb domain
CDDcd001674.59E-51963No hitNo description
PROSITE profilePS5129425.06164118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-2467118IPR009057Homeodomain-like
SMARTSM007173.5E-1368116IPR001005SANT/Myb domain
PfamPF002499.1E-1469114IPR001005SANT/Myb domain
CDDcd001677.66E-1072114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MEECTDQKPT KPKHRKGLWS PEEDHRLRSY IVKNGHGCRT TVPIHAGLQR NGKSCRLRWI  60
NYLRPGLKRG LFSAYEEDTI VTLHRLLGNK WSQISQHLPG RTDNEIKNHW HSYLKKKLTK  120
SQGIASHDNN NKIQQCPTSC NSDNNTSTYH NLSPDHRDES SPSSTTTTAV DQCSVPLFPP  180
KLMFAEWLSM DSFPANPAAE PLFCNKDFAS GSHDFGLDIP NGGFFGDNLF QGYQLCGERG  240
GYQNSMATTV SDGSASDVFS SQFNFEDQSS DNSDQFVEFC SDFQINSDSV LYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-21161187108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744440.0JX174444.1 Linum usitatissimum clone LuBAC317I7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321912.22e-85hypothetical protein POPTR_0015s13190g
SwissprotQ9M0K43e-59LAF1_ARATH; Transcription factor LAF1
TrEMBLB9ID762e-85B9ID76_POPTR; Uncharacterized protein
STRINGPOPTR_0015s13190.15e-85(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.12e-60myb domain protein 18